LGR5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86627-1-RR (same clone as 86627-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86627-1-RR (LGR5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86627-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86627-1-RR (same clone as 86627-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86627-1-RR (LGR5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86627-1-PBS in a different storage buffer formulation.

LGR5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86627-1-PBS

Clone No.251491A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

FEX, GPR49, GPR67, G-protein coupled receptor 49, G-protein coupled receptor 67

---

Product Information

86627-1-PBS targets LGR5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31625

  Product name: Recombinant human LGR5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 824-907 aa of BC096324

  Sequence: NPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL

• Full Name: leucine-rich repeat-containing G protein-coupled receptor 5
• Calculated Molecular Weight: 907 aa, 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC096324
• Gene Symbol: LGR5
• Gene ID (NCBI): 8549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75473
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5) also known as G-protein coupled receptor 49 (GPR49) or G-protein coupled receptor 67 (GPR67) is a protein that in humans is encoded by the LGR5 gene. It is a member of GPCR class A receptor proteins. R-spondin proteins are the biological ligands of LGR5. LGR5 is expressed across a diverse range of tissue such as in the muscle, placenta, spinal cord and brain and particularly as a biomarker of adult stem cells in certain tissues.LGR5 is crucial during embryogenesis as LGR null studies in mice incurred 100% neonatal mortality accompanied by several craniofacial distortions such as ankyloglossia and gastrointestinal dilation (PMID: 9642114, 16575208, 525477).