LGR5 Recombinant monoclonal antibody

• 

  WB analysis using 86627-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86627-1-RR (LGR5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86627-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86627-1-RR (LGR5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

LGR5 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86627-1-RR

Clone No.251491A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

FEX, GPR49, GPR67, G-protein coupled receptor 49, G-protein coupled receptor 67

---

Tested Applications

• Positive WB detected in: HEK-293 cells, BGC-823 cells, SGC-7901 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86627-1-RR targets LGR5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31625

  Product name: Recombinant human LGR5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 824-907 aa of BC096324

  Sequence: NPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL

• Full Name: leucine-rich repeat-containing G protein-coupled receptor 5
• Calculated Molecular Weight: 907 aa, 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC096324
• Gene Symbol: LGR5
• Gene ID (NCBI): 8549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75473
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5) also known as G-protein coupled receptor 49 (GPR49) or G-protein coupled receptor 67 (GPR67) is a protein that in humans is encoded by the LGR5 gene. It is a member of GPCR class A receptor proteins. R-spondin proteins are the biological ligands of LGR5. LGR5 is expressed across a diverse range of tissue such as in the muscle, placenta, spinal cord and brain and particularly as a biomarker of adult stem cells in certain tissues.LGR5 is crucial during embryogenesis as LGR null studies in mice incurred 100% neonatal mortality accompanied by several craniofacial distortions such as ankyloglossia and gastrointestinal dilation (PMID: 9642114, 16575208, 525477).