LHFPL4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LHFPL4 Polyclonal antibody, PBS Only (21094-1-PBS)

• 

  WB analysis using 21094-1-AP (same clone as 21094-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21094-1-AP (LHFPL4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21094-1-PBS in a different storage buffer formulation.

LHFPL4 Polyclonal Antibody for WB, ELISA

Cat No. 21094-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Lipoma HMGIC fusion partner-like 4 protein, LHFPL tetraspan subfamily member 4 protein, GARLH4, GABAA receptor regulatory Lhfpl4

---

Product Information

21094-1-PBS targets LHFPL4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15349

  Product name: Recombinant human LHFPL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 197-247 aa of BC113964

  Sequence: LGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP

• Full Name: lipoma HMGIC fusion partner-like 4
• Calculated Molecular Weight: 247 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC113964
• Gene Symbol: LHFPL4
• Gene ID (NCBI): 375323
• RRID: AB_3669357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q7Z7J7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LHFPL4, or Lipoma HMGIC Fusion Partner-Like 4, is a member of the tetraspanin superfamily of transmembrane proteins. LHFPL4 interacts tightly with GABAAR subunits and is selectively enriched at inhibitory synapses. It is important for GABAAR clustering both in vitro and in vivo, and it is required for surface clustering but not the trafficking of GABAARs (PMID: 28978485).