LIG1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67840-1-Ig (same clone as 67840-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67840-1-Ig (LIG1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67840-1-PBS in a different storage buffer formulation.

LIG1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67840-1-PBS

Clone No.3D9G8

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

DNA ligase 1, DNA ligase I, LIG1, ligase I, DNA, ATP dependent

---

Product Information

67840-1-PBS targets LIG1 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12489

  Product name: Recombinant human LIG1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 670-919 aa of BC108318

  Sequence: LVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY

• Full Name: ligase I, DNA, ATP-dependent
• Calculated Molecular Weight: 919 aa, 102 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC108318
• Gene Symbol: LIG1
• Gene ID (NCBI): 3978
• RRID: AB_2918602
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18858
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNA ligase I (LIG1) joins DNA strand breaks during DNA replication and repair transactions and contributes to genome integrity. 67840-1-Ig is raised agains the C-terminal 670-919 aa residues of the human DNA ligase 1.