CoraLite® Plus 488 Anti-Human LIGHT/CD258 Rabbit scFv Antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488 Anti-Human LIGHT/CD258 Rabbit scFv Antibody (CL488-SF98063)

• Site-specific conjugation

LIGHT/CD258 Recombinant Antibody for FC

Cat No. CL488-SF98063

Clone No.240694D7

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

Synonyms

LIGHT, CD258, HVEM L, HVEML, HVEM-L

• 

  FC experiment of human PBMCs using CL488-SF98063

  1x10^6 untreated (left) or PMA and ionomycin treated (right) human PBMCs were surface stained with CoraLite® Plus 405 Anti-Human CD8 (SK1) and 0.25 ug CoraLite® Plus 488 Anti-Human LIGHT/CD258 Rabbit scFv Antibody (CL488-SF98063, Clone: 240694D7). Cells were not fixed.

• 

  FC experiment of human PBMCs using CL488-SF98063

  1x10^6 PMA and ionomycin treated human PBMCs were surface stained with 0.25 ug CoraLite® Plus 488 Anti-Human LIGHT/CD258 Rabbit scFv Antibody (CL488-SF98063, Clone: 240694D7) (red) or 0.25 ug CoraLite® Plus 488 Rabbit scFv Isotype Control (CL488-SF98136, Clone: 240953C9) (blue). 1x10^6 untreated human PBMCs were surface stained with 0.25 ug CoraLite® Plus 488 Anti-Human LIGHT/CD258 Rabbit scFv Antibody (CL488-SF98063, Clone: 240694D7) (black, dashed). Cells were not fixed.

---

Tested Applications

• Positive FC detected in: PMA and ionomycin treated human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-SF98063 targets LIGHT/CD258 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg32095

  Product name: Recombinant Human LIGHT/CD258 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: N-6*his

  Domain: 74-240 aa of NM_003807

  Sequence: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

• Full Name: tumor necrosis factor (ligand) superfamily, member 14
• Calculated Molecular Weight: 26KD
• GenBank Accession Number: NM_003807
• Gene Symbol: LIGHT
• Gene ID (NCBI): 8740
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Source: Anti-Human LIGHT/CD258 scFv from clone 240694D7, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

LIGHT, also known as TNFSF14, HVEML, or CD258, is a type II transmembrane protein that belongs to the TNF superfamily (PMID: 9462508). It is predominantly expressed in lymphoid tissues and produced by activated T cells and immature dendritic cells (DCs) (PMID: 9462508; 10754304). Through its two primary functional receptors HVEM (TNFRSF14) and lymphotoxin β receptor (LTβR), LIGHT signaling is involved in development and maintenance of lymphoid tissues, as well as innate and adaptive immune responses (PMID: 24575096; 26720335). In addition to the membrane form, LIGHT can also exist as a soluble form generated by cleavage of the extracellular portion of the membrane form.