Anti-Human LIGHT/CD258 Rabbit scFv Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Anti-Human LIGHT/CD258 Rabbit scFv Antibody, PBS Only (SF98063-1-PBS)

• 

  FC experiment of human PBMCs using SF98063-1-RR (same clone as SF98063-1-PBS)

  1x10^6 untreated or PMA and ionomycin treated human PBMCs were surface stained with 0.25 ug Anti-Human LIGHT/CD258 Rabbit scFv Antibody (SF98063-1-RR, Clone: 240694D7) and PE Anti-6*His, His-Tag Rabbit RecAb (PE-FcA98450, Clone: 251107A1). Cells were then stained with CL647 Anti-Human CD8. Cells were not fixed. This data was developed using the same antibody clone with SF98063-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human PBMCs using SF98063-1-RR (same clone as SF98063-1-PBS)

  1x10^6 PMA and ionomycin treated human PBMCs were surface stained with 0.25 ug anti-human LIGHT/CD258 Recombinant Antibody (SF98063-1-RR, Clone: 240694D7) (red) or 0.25 ug Rabbit IgG Isotype Control Rabbit scFv Antibody (SF98136-1-RR, Clone: 240953C9) (blue), and PE Anti-6*His, His-Tag Rabbit RecAb (PE-FcA98450, Clone: 251107A1). 1x10^6 untreated human PBMCs were surface stained with 0.25 ug anti-human LIGHT/CD258 Recombinant Antibody (SF98063-1-RR, Clone: 240694D7) (black, dashed) and PE Anti-6*His, His-Tag Rabbit RecAb (PE-FcA98450, Clone: 251107A1). Cells were not fixed. This data was developed using the same antibody clone with SF98063-1-PBS in a different storage buffer formulation.

• 

  Affinity of SF98063-1-RR

  Biolayer interferometry (BLl) kinetic assays of SF98063-1-RR against Human LIGHT/CD258 were performed. The affinity constant is 1.72 nM.

LIGHT/CD258 Recombinant Antibody for FC, Indirect ELISA

Cat No. SF98063-1-PBS

Clone No.240694D7

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC, Indirect ELISA

Synonyms

LIGHT, CD258, HVEM L, HVEML, HVEM-L

---

Product Information

SF98063-1-PBS targets LIGHT/CD258 in FC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg32095

  Product name: Recombinant Human LIGHT/CD258 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: N-6*his

  Domain: 74-240 aa of NM_003807

  Sequence: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

• Full Name: tumor necrosis factor (ligand) superfamily, member 14
• Calculated Molecular Weight: 26KD
• GenBank Accession Number: NM_003807
• Gene Symbol: LIGHT
• Gene ID (NCBI): 8740
• RRID: AB_3750146
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LIGHT, also known as TNFSF14, HVEML, or CD258, is a type II transmembrane protein that belongs to the TNF superfamily (PMID: 9462508). It is predominantly expressed in lymphoid tissues and produced by activated T cells and immature dendritic cells (DCs) (PMID: 9462508; 10754304). Through its two primary functional receptors HVEM (TNFRSF14) and lymphotoxin β receptor (LTβR), LIGHT signaling is involved in development and maintenance of lymphoid tissues, as well as innate and adaptive immune responses (PMID: 24575096; 26720335). In addition to the membrane form, LIGHT can also exist as a soluble form generated by cleavage of the extracellular portion of the membrane form.