Anti-Human LILRA6/CD85b Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human LILRA6/CD85b Rabbit Recombinant Antibody, PBS Only (98479-1-PBS)

• 

  FC experiment of human peripheral blood leukocyte using 98479-1-RR (same clone as 98479-1-PBS)

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human LILRA6/CD85b Rabbit RecAb (98479-1-RR, Clone:250333G1) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98479-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human peripheral blood leukocyte using 98479-1-RR (same clone as 98479-1-PBS)

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human LILRA6/CD85b Rabbit RecAb (98479-1-RR, Clone:250333G1) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98479-1-PBS in a different storage buffer formulation.

LILRA6/CD85b Uni-rAb^® Recombinant Antibody for FC

Cat No. 98479-1-PBS

Clone No.250333G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD85b, ILT8, ILT-8, Immunoglobulin-like transcript 8, Leucocyte Ig-Like Receptor A6

---

Product Information

98479-1-PBS targets LILRA6/CD85b in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3776

  Product name: Recombinant Human LILRA6 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-447 aa of BC156794

  Sequence: GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN

• Full Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6
• GenBank Accession Number: BC156794
• Gene Symbol: LILRA6
• Gene ID (NCBI): 79168
• RRID: AB_3746109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6PI73
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Leukocyte immunoglobulin-like receptor subfamily A member 6 belongs to the leukocyte immunoglobulin-like receptors (LILRs, also known as ILTs and LIRs). Among 11 family members, inhibitory LILRB3 (ILT5, LIR3) and activating LILRA6 (ILT8) represent a unique homologous receptor pair characterized by highly polymorphic ectodomains. (PMID: 36449053; 24257760)