LILRB2/CD85d Polyclonal antibody

• 

  WB analysis using 14154-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14154-1-AP (LILRB2/CD85d antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of THP-1 using 14154-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using LILRB2/CD85d antibody (14154-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

LILRB2/CD85d Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14154-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

LILRB2, CD85 antigen-like family member D, CD85d, ILT 4, ILT4

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, THP-1 cells
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14154-1-AP targets LILRB2/CD85d in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5336

  Product name: Recombinant human LILRB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-350 aa of BC036827

  Sequence: GTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQ

• Full Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
• Calculated Molecular Weight: 598 aa, 65 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC036827
• Gene Symbol: LILRB2
• Gene ID (NCBI): 10288
• RRID: AB_3669180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N423
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LILRB2 (Leukocyte immunoglobulin-like receptor subfamily B member 2), also known as ILT4, CD85d or MIR10, is a type I transmembrane glycoprotein that contains four extracellular immunoglobulin domains, a transmembrane domain, and three cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs) (PMID: 33928233). LILRB2 is mainly expressed in immunocytes including monocytes, macrophages, and dendritic cells, and transduces negative signals by its association with SHP-1 phosphatase via the ITIMs (PMID: 35717259). LILRB2 can interact with various ligands such as HLA-A, HLA-B, HLA-C, HLA-G, HLA-F, CD1c, CD1d, angiopoietin-like proteins (ANGPTLs), and SEMA4A.