LIN28A Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00699-1

  Sandwich ELISA standard curve of MP00699-1, Human LIN28A Recombinant Matched Antibody Pair - PBS only. 83748-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag2312. 83748-2-PBS was HRP conjugated as the detection antibody. Range: 1.17-75 ng/mL

• 

  Sample test of MP00699-1

  NCCIT cell lysate was measured.The human LIN28A concentration of detected samples was determined to be 433.7 ng/mg total protein.

• 

  Cytometric bead array standard curve of MP00699-1

  Cytometric bead array standard curve of MP00699-1, LIN28A Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83748-4-PBS. Detection antibody: 83748-2-PBS. Standard: Ag2312. Range: 0.78-100 ng/mL

LIN28A Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83748-4-PBS

Clone No.240683A9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Lin-28A, LIN28, Lin 28A, LIN 28, CSDD1

---

Product Information

83748-4-PBS targets LIN28A as part of a matched antibody pair:

MP00699-1: 83748-4-PBS capture and 83748-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2312

  Product name: Recombinant human LIN28 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-209 aa of BC028566

  Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN

• Full Name: lin-28 homolog (C. elegans)
• Calculated Molecular Weight: 209 aa, 23 kDa
• GenBank Accession Number: BC028566
• Gene Symbol: LIN28
• Gene ID (NCBI): 79727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H9Z2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.