LIN7C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LIN7C Polyclonal antibody (14656-1-AP)

LIN7C Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14656-1-AP Copied!

Publications (1)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

VELI3, Protein lin-7 homolog C, Mammalian lin-seven protein 3, MALS-3, MALS3

• 

  WB analysis of human cerebellum using 14656-1-AP

  human cerebellum tissue were subjected to SDS PAGE followed by western blot with 14656-1-AP (LIN7C antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 14656-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14656-1-AP (LIN7C antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 14656-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 14656-1-AP (LIN7C antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 14656-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 14656-1-AP (LIN7C antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 14656-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 14656-1-AP (LIN7C antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LIN7C in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human cerebellum tissue, human brain tissue, human kidney tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14656-1-AP targets LIN7C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6265

  Product name: Recombinant human LIN7C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-197 aa of BC053907

  Sequence: MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT

• Full Name: lin-7 homolog C (C. elegans)
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC053907
• Gene Symbol: LIN7C
• Gene ID (NCBI): 55327
• RRID: AB_2135197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NUP9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The LIN7C Polyclonal antibody (Cat# 14656-1-AP) has 1 total citation. It was cited in Neuroscience (2012), in a study on proteome analysis of actin filament-associated proteins in the postnatal rat cerebellum, using WB on rat samples. The associated research field is neuroscience, specifically cerebellar development and actin cytoskeleton biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Neuroscience; Proteome analysis of actin filament-associated proteins in the postnatal rat cerebellum.; Authors - Shi N N

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is a 5-star rating from a Western Blot application. The reviewer tested it on HCT116, Caco2, and MDCK cell lines at a 1:1000 dilution and reported good specificity, noting that the antibody also cross-reacts with canine Lin7c. Overall, the feedback is positive, highlighting reliable performance and broad reactivity.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Thomas (Verified Customer) (11-17-2020)

Good specifity, also binds canine Lin7c

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HCT116 (human, colon cancer cell line), Caco2 (human, colorectal adenocarcinoma cell line) , MDCK (canine, kidney tubule)

LIN7C Antibody Western Blot validation (1:1000 dilution) in HCT116 (human, colon cancer cell line), Caco2 (human, colorectal adenocarcinoma cell line) , MDCK (canine, kidney tubule) (Cat no:14656-1-AP)