LINGO3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LINGO3 Polyclonal antibody, PBS Only (32267-1-PBS)

• 

  WB analysis using 32267-1-AP (same clone as 32267-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32267-1-AP (LINGO3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32267-1-PBS in a different storage buffer formulation.

LINGO3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32267-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

LERN2, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3, Leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 6B, LRRN6B

---

Product Information

32267-1-PBS targets LINGO3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37289

  Product name: Recombinant human LINGO3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 360-530 aa of NM_001101391

  Sequence: LLWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCRAEGEPAPTVAWVTPQHRPVTATSAGRARVLPGGTLEIQDARPQDSGTYTCVASNAGGNDTYFATLTVRPEPAANRTPGEAHNETLAALRAPLDLTTILVS

• Full Name: leucine rich repeat and Ig domain containing 3
• Calculated Molecular Weight: 64kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: NM_001101391
• Gene Symbol: LINGO3
• Gene ID (NCBI): 645191
• RRID: AB_3742558
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0C6S8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LINGO3 represents a previously unrecognized factor that promotes mucosal wound healing. It partially transduces the repair signals of TFF2, especially through the MAPK signaling cascade, and facilitates epithelial regeneration by preserving the intestinal stem cell microenvironment and maintaining Lgr5 expression (PMID: 33941035).