LINGO3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LINGO3 Polyclonal antibody, PBS Only (32267-1-PBS)

• 

  WB analysis using 32267-1-AP (same clone as 32267-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32267-1-AP (LINGO3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32267-1-PBS in a different storage buffer formulation.

LINGO3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32267-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

LERN2, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3, Leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 6B, LRRN6B

---

Product Information

32267-1-PBS targets LINGO3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37289

  Product name: Recombinant human LINGO3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 360-530 aa of NM_001101391

  Sequence: LLWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCRAEGEPAPTVAWVTPQHRPVTATSAGRARVLPGGTLEIQDARPQDSGTYTCVASNAGGNDTYFATLTVRPEPAANRTPGEAHNETLAALRAPLDLTTILVS

• Full Name: leucine rich repeat and Ig domain containing 3
• Calculated Molecular Weight: 64kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: NM_001101391
• Gene Symbol: LINGO3
• Gene ID (NCBI): 645191
• RRID: AB_3742558
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0C6S8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.