LIPA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LIPA Polyclonal antibody (12956-1-AP)

• Featured Product
• KD/KO Validated

LIPA Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12956-1-AP Copied!

Publications (24)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CESD, Cholesteryl esterase, EC:3.1.1.13, Lipase A, LipaseA

• 

  WB analysis of HEK-293 using 12956-1-AP

  WB result of LIPA antibody (12956-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LIPA transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-1080 using 12956-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of RAW 264.7 using 12956-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 12956-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12956-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 12956-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-1080 using 12956-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 12956-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HT-1080 using 12956-1-AP

  IP result of anti-LIPA (IP:12956-1-AP, 4ug; Detection:12956-1-AP 1:2000) with HT-1080 cells lysate 3600 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12956-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12956-1-AP (LIPA antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12956-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12956-1-AP (LIPA antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LIPA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HeLa cells, HEK-293 cells, HepG2 cells, RAW 264.7 cells, NIH/3T3 cells
• Positive IP detected in: HT-1080 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12956-1-AP targets LIPA in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3627

  Product name: Recombinant human LIPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-200 aa of BC012287

  Sequence: WPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFAL

• Full Name: lipase A, lysosomal acid, cholesterol esterase
• Calculated Molecular Weight: 399 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC012287
• Gene Symbol: LIPA
• Gene ID (NCBI): 3988
• RRID: AB_2078477
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P38571
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human acid lipase/cholesteryl esterase (LIPA) is a 46-kDa glycoprotein required for the lysosomal hydrolysis of cholesteryl esters and triglycerides that cells acquire through the receptor-mediated endocytosis of low-density lipoproteins(PMID:8432549). Defects in LIPA are the cause of Wolman disease (WOD)(PMID:8146180) and cholesteryl ester storage disease (CESD)(PMID:9633819). It has 2 isoforms produced by alternative splicing with the molecular weight of 45 kDa and 39 kDa. The full length protein has a signal peptide and several glycosylation sites.

Publications

What published studies show

Anti-LIPA (Lysosomal Acid Lipase) antibody, catalog number 12956-1-AP, has 24 citations across journals including Cell Metabolism, Nature Communications, Neuron, Cancer Research, Advanced Science, Cell Reports, Cell Death & Disease, iMeta, Phytomedicine, Life Sciences, Hepatology Communications, Nutrients, Journal of Neuroinflammation, Veterinary Research, International Immunopharmacology, bioRxiv, and others. Research fields span lipid metabolism, liver disease/NAFLD, multiple cancer types, neuroinflammation/Alzheimer's, macrophage biology, and viral replication.

Automatically generated from the 24 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Imeta; Cross-tissue multi-omics analyses reveal the gut microbiota's absence impacts organ morphology, immune homeostasis, bile acid and lipid metabolism; Authors - Juan Shen
mouse	WB	Cell Metab; Hepatic lipid remodeling in cold exposure uncovers direct regulation of bis(monoacylglycero)phosphate lipids by phospholipase A2 group XV; Authors - Jessica W Davidson
human	WB	Cancer Commun (Lond); Squalene epoxidase promotes colorectal cancer cell proliferation through accumulating calcitriol and activating CYP24A1-mediated MAPK signaling.; Authors - Luwei He
human	WB	Cancer Res; KRAS Signaling Inhibition Induces a Targetable Metabolic Dependency on Lipophagy-Dependent Fatty Acid Oxidation in Pancreatic Cancer.; Authors - Ravi Thakur ; KD Validated
mouse	WB	Nat Commun; CD276-dependent efferocytosis by tumor-associated macrophages promotes immune evasion in bladder cancer; Authors - Maosheng Cheng
		Neuron; Transcriptional regulation of disease-relevant microglial activation programs.; Authors - Amanda McQuade