LIPA Polyclonal antibody

• 

  WB analysis of HEK-293 using 12956-1-AP

  WB result of LIPA antibody (12956-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LIPA transfected HEK-293 cells.

• 

  WB analysis of HT-1080 using 12956-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 12956-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-1080 using 12956-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 12956-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 12956-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 12956-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12956-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12956-1-AP (LIPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HT-1080 using 12956-1-AP

  IP result of anti-LIPA (IP:12956-1-AP, 4ug; Detection:12956-1-AP 1:2000) with HT-1080 cells lysate 3600 ug.

• 

  IHC staining of human colon cancer using 12956-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12956-1-AP (LIPA antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 12956-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12956-1-AP (LIPA antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

LIPA Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12956-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

LipaseA, Lipase A, EC:3.1.1.13, Cholesteryl esterase, CESD

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HeLa cells, HEK-293 cells, HepG2 cells, RAW 264.7 cells, NIH/3T3 cells
• Positive IP detected in: HT-1080 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

12956-1-AP targets LIPA in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3627

  Product name: Recombinant human LIPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-200 aa of BC012287

  Sequence: WPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFAL

• Full Name: lipase A, lysosomal acid, cholesterol esterase
• Calculated Molecular Weight: 399 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC012287
• Gene Symbol: LIPA
• Gene ID (NCBI): 3988
• RRID: AB_2078477
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P38571
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human acid lipase/cholesteryl esterase (LIPA) is a 46-kDa glycoprotein required for the lysosomal hydrolysis of cholesteryl esters and triglycerides that cells acquire through the receptor-mediated endocytosis of low-density lipoproteins(PMID:8432549). Defects in LIPA are the cause of Wolman disease (WOD)(PMID:8146180) and cholesteryl ester storage disease (CESD)(PMID:9633819). It has 2 isoforms produced by alternative splicing with the molecular weight of 45 kDa and 39 kDa. The full length protein has a signal peptide and several glycosylation sites.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Commun (Lond); Squalene epoxidase promotes colorectal cancer cell proliferation through accumulating calcitriol and activating CYP24A1-mediated MAPK signaling.; Authors - Luwei He
pig	WB	Vet Res; The cholesterol metabolite 25-hydroxycholesterol suppresses porcine deltacoronavirus via lipophagy inhibition and mTORC1 modulation; Authors - Jia-Lu Zhang
rat	WB	Phytomedicine; Morroniside, a novel GATA3 binding molecule, inhibits hepatic stellate cells activation by enhancing lysosomal acid lipase expression.; Authors - Lin An
rat	WB	J Oncol; CircRNA-Associated ceRNA Network Reveals Focal Adhesion and Metabolism Pathways in Neuropathic Pain; Authors - Kun Wang
human,mouse	WB,IHC,IF,IP	Cell Death Dis; Molecular and histological traits of reduced lysosomal acid lipase activity in the fatty liver.; Authors - Simone Carotti
	IF	Imeta; Cross-tissue multi-omics analyses reveal the gut microbiota's absence impacts organ morphology, immune homeostasis, bile acid and lipid metabolism; Authors - Juan Shen