LITAF Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LITAF Polyclonal antibody, PBS Only (16797-1-PBS)

• 

  WB analysis of HeLa using 16797-1-AP (same clone as 16797-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16797-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16797-1-AP (same clone as 16797-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16797-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16797-1-AP (same clone as 16797-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16797-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 16797-1-AP (same clone as 16797-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16797-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 16797-1-AP (same clone as 16797-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16797-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 16797-1-AP (same clone as 16797-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16797-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 16797-1-AP (same clone as 16797-1-PBS)

  IP result of anti-LITAF (IP:16797-1-AP, 4ug; Detection:16797-1-AP 1:600) with HeLa cells lysate 1520ug. This data was developed using the same antibody clone with 16797-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 16797-1-AP (same clone as 16797-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 16797-1-AP (LITAF antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16797-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 16797-1-AP (same clone as 16797-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 16797-1-AP (LITAF antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16797-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16797-1-AP (same clone as 16797-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 16797-1-AP (LITAF antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16797-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LITAF Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 16797-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

16797-1-PBS targets LITAF in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10269

  Product name: Recombinant human LITAF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-119 aa of BC008309

  Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSC

• Full Name: lipopolysaccharide-induced TNF factor
• Calculated Molecular Weight: 161 aa, 17 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC008309
• Gene Symbol: LITAF
• Gene ID (NCBI): 9516
• RRID: AB_2135710
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99732
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Lipopolysaccharide-induced TNF factor(LITAF) is a transcription factor that identified as a regulator of TNF-alpha gene expression. It may has a role in protein degradation pathways and in tumor necrosis factor alpha(TNF-alpha) gene expression. Also it may regulate the expression of the CCL2/MCP-1 chemokine through NFKB1.Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis