LIX1L Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• LIX1L Recombinant monoclonal antibody (86712-3-RR)

• 

  WB analysis using 86712-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86712-3-RR (LIX1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 86712-3-RR

  IP result of anti-LIX1L (IP:86712-3-RR, 4ug; Detection:86712-3-RR 1:1500) with Jurkat cells lysate 1800 ug.

• 

  Affinity and Kinetic Characterization of 86712-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86712-3-RR against Human LIX1L were performed. The affinity constant is 0.376 nM.

LIX1L Uni-rAb^® Recombinant Antibody for WB, IP, ELISA

Cat No. 86712-3-RR

Clone No.251679D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

LIX1-like protein

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, SH-SY5Y cells, K-562 cells, HL-60 cells
• Positive IP detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86712-3-RR targets LIX1L in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22209

  Product name: Recombinant human LIX1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC035727

  Sequence: METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSGAPGLPLPPGAAGSPAVLREAVEAVVRSFAKHTQGYGRVNVVE

• Full Name: Lix1 homolog (mouse)-like
• Calculated Molecular Weight: 337 aa, 37 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC035727
• Gene Symbol: LIX1L
• Gene ID (NCBI): 128077
• RRID: AB_3745071
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IVB5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Limb expression 1-like protein (LIX1L) is a putative RNA binding protein that contains a double-stranded RNA-binding motif. LIX1L is highly expressed in various cancer tissues.