LLGL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LLGL1 Polyclonal antibody, PBS Only (22496-1-PBS)

• 

  WB analysis using 22496-1-AP (same clone as 22496-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 22496-1-AP (LLGL1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22496-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 22496-1-AP (same clone as 22496-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LLGL1 antibody (22496-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 22496-1-PBS in a different storage buffer formulation.

LLGL1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 22496-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

lethal giant larvae homolog 1 (Drosophila), Hugl-1, Hugl1

---

Product Information

22496-1-PBS targets LLGL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18057

  Product name: Recombinant human LLGL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 67-212 aa of BC151838

  Sequence: EFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVTVVLLVAAGDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTKIL

• Full Name: lethal giant larvae homolog 1 (Drosophila)
• Calculated Molecular Weight: 1064 aa, 115 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC151838
• Gene Symbol: LLGL1
• Gene ID (NCBI): 3996
• RRID: AB_3669400
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q15334
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Lethal giant larvae (Lgl) is a scaffolding protein that regulates the establishment of apical-basal polarity in epithelial cells. The human homologs of Lgl are known as LLGL1 and LLGL2. LLGL1 is a tumor suppressor in multiple human cancers, including hepatocellular carcinoma, malignant melanoma, and colorectal cancer (PMID: 34178676; 15735678; 16170365). LLGL2 functions as a promoter of tumor growth and not as a tumor suppressor in ER+ breast cancer (PMID: 30996345).