LLGL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LLGL2 Polyclonal antibody, PBS Only (15993-1-PBS)

• 

  WB analysis using 15993-1-AP (same clone as 15993-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15993-1-AP (LLGL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15993-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovarian cancer using 15993-1-AP (same clone as 15993-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 15993-1-AP (LLGL2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15993-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15993-1-AP (same clone as 15993-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LLGL2 antibody (15993-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 15993-1-PBS in a different storage buffer formulation.

LLGL2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15993-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HGL, Lethal(2) giant larvae protein homolog 2, LLGL scribble cell polarity complex component 2

---

Product Information

15993-1-PBS targets LLGL2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8867

  Product name: Recombinant human LLGL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-356 aa of BC010879

  Sequence: MRRFLRPGHDPVRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAASRRASGVGAQG

• Full Name: lethal giant larvae homolog 2 (Drosophila)
• Calculated Molecular Weight: 356aa,40 kDa; 1020aa,113 kDa
• Observed Molecular Weight: 113-120 kDa
• GenBank Accession Number: BC010879
• Gene Symbol: LLGL2
• Gene ID (NCBI): 3993
• RRID: AB_3085478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P1M3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Lethal giant larvae (Lgl) is a scaffolding protein that regulates the establishment of apical-basal polarity in epithelial cells. The human homologs of Lgl are known as LLGL1 and LLGL2. LLGL1 is a tumor suppressor in multiple human cancers, including hepatocellular carcinoma, malignant melanoma, and colorectal cancer (PMID: 34178676; 15735678; 16170365). LLGL2 functions as a promoter of tumor growth and not as a tumor suppressor in ER+ breast cancer (PMID: 30996345).