LMBR1L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LMBR1L Polyclonal antibody, PBS Only (12154-1-PBS)

• 

  WB analysis of mouse testis using 12154-1-AP (same clone as 12154-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12154-1-AP (LMBR1L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12154-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat testis using 12154-1-AP (same clone as 12154-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 12154-1-AP (LMBR1L antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12154-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 12154-1-AP (same clone as 12154-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12154-1-AP (LMBR1L antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12154-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 12154-1-AP (same clone as 12154-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12154-1-AP (LMBR1L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12154-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 12154-1-AP (same clone as 12154-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 12154-1-AP (LMBR1L antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12154-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 12154-1-AP (same clone as 12154-1-PBS)

  IP result of anti-LMBR1L (IP:12154-1-AP, 4ug; Detection:12154-1-AP 1:500) with HepG2 cells lysate 3200ug. This data was developed using the same antibody clone with 12154-1-PBS in a different storage buffer formulation.

LMBR1L Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 12154-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

12154-1-PBS targets LMBR1L in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2787

  Product name: Recombinant human LMBR1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 219-490 aa of BC015015

  Sequence: RMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQTQRVLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAIHILELLIDEAAMPRGMQGTSLGQVSFSKLGSFGAVIQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAAVRAELIRAFGLDRLPLPVSGFPQASRKTQHQ

• Full Name: limb region 1 homolog (mouse)-like
• Calculated Molecular Weight: 489 aa, 55 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC015015
• Gene Symbol: LMBR1L
• Gene ID (NCBI): 55716
• RRID: AB_2136130
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UX01
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LMBR1L, also known as LIMR (lipocalin-1-interacting membrane receptor), interacts with lipocalin-1 (Lcn-1), a lipocalin member produced by a number of secretoric glands and tissues and known to bind a variety of lipophilic compounds. LMBR1L is a 489-amino acid protein with a predicted molecular mass of 55 kD and 9 putative transmembrane helices. LMBR1L has been shown to mediate cellular uptake of LMBR1L, thus it is characterized as a endocytic receptor (PMID: 11287427; 12591932). Alternatively spliced transcript variants encoding different isoforms have been described.