LMCD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LMCD1 Polyclonal antibody, PBS Only (15175-1-PBS)

• 

  WB analysis using 15175-1-AP (same clone as 15175-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15175-1-AP (LMCD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15175-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15175-1-AP (same clone as 15175-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15175-1-AP (LMCD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15175-1-PBS in a different storage buffer formulation.

LMCD1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15175-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Dyxin, LIM and cysteine-rich domains protein 1

---

Product Information

15175-1-PBS targets LMCD1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7068

  Product name: Recombinant human LMCD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-365 aa of BC000646

  Sequence: MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

• Full Name: LIM and cysteine-rich domains 1
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41-45 kDa
• GenBank Accession Number: BC000646
• Gene Symbol: LMCD1
• Gene ID (NCBI): 29995
• RRID: AB_3741859
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZU5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LIM and cysteine-rich domains-1 (LMCD1) is a member of the LIM protein family, which contains an N-terminal cysteine-rich region, two C-terminal LIM domains and a central PET (Prickle, Espinas, and Testin) domain. LMCD1 has been reported in cardiac tissues and lung acting as a transcriptional repressor for GATA6. The mutations of LMCD1 promote cell migration and tumor metastasis in hepatocellular carcinoma. (PMID: 31501411) It has calculated molecular weight around 41kDa.