LMO1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LMO1 Polyclonal antibody, PBS Only (26932-1-PBS)

• 

  WB analysis of mouse brain using 26932-1-AP (same clone as 26932-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26932-1-AP (LMO1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26932-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26932-1-AP (same clone as 26932-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26932-1-AP (LMO1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26932-1-PBS in a different storage buffer formulation.

LMO1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26932-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Cysteine-rich protein TTG-1, LIM domain only protein 1, LMO 1, LMO-1, RBTN1

---

Product Information

26932-1-PBS targets LMO1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25607

  Product name: Recombinant human LMO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 11-83 aa of BC069793

  Sequence: PMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFG

• Full Name: LIM domain only 1 (rhombotin 1)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC069793
• Gene Symbol: LMO1
• Gene ID (NCBI): 4004
• RRID: AB_3085916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25800
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LOM1 (LIM Domain Only 1), as a Protein Coding gene, encodes a cysteine-rich, two LIM domain transcriptional regulator. It may be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL)(Uniprot). Diseases associated with LMO1 include T-Cell Acute Lymphoblastic Leukemia and Neuroblastoma (PMID:31830377). The downstream of LMO1-regulatory cascade includes a tumor-promoting LIMS1/ILK pathway, which has a potential to be a novel therapeutic target(PMID: 29695398). The molecular weight of LMO1 is 18 kDa.