LMO7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LMO7 Polyclonal antibody, PBS Only (29392-1-PBS)

• 

  WB analysis using 29392-1-AP (same clone as 29392-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29392-1-AP (LMO7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29392-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 29392-1-AP (same clone as 29392-1-PBS)

  WB result of LMO7 antibody (29392-1-AP; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LMO7 transfected HeLa cells. This data was developed using the same antibody clone with 29392-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 29392-1-AP (same clone as 29392-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 29392-1-AP (LMO7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29392-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 29392-1-AP (same clone as 29392-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 29392-1-AP (LMO7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29392-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 29392-1-AP (same clone as 29392-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 29392-1-AP (LMO7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29392-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 29392-1-AP (same clone as 29392-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 29392-1-AP (LMO7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29392-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 29392-1-AP (same clone as 29392-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using LMO7 antibody (29392-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 29392-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LMO7 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29392-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FBX20, LOMP

---

Product Information

29392-1-PBS targets LMO7 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30016

  Product name: Recombinant human LMO7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 695-838 aa of NM_005358

  Sequence: KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY

• Full Name: LIM domain 7
• Calculated Molecular Weight: 193 kDa
• Observed Molecular Weight: 140-160 kDa
• GenBank Accession Number: NM_005358
• Gene Symbol: LMO7
• Gene ID (NCBI): 4008
• RRID: AB_3086128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWI1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LMO7, also known as LOMP, FBX20, belongs to the single Calponin-homology (CH) domain-containing protein family, with a single actin-binding CH domain at the amino terminal end(PMID: 19459066). LMO7 also contains a PDZ domain and a carboxyl-terminal LIM domain, both of which have been described as protein-protein interacting domains(PMID: 15140894). LMO7 encodes three splice variants of calculated molecular weights of 196 kDa (P200), 157 kDa (P150), and 100 kDa (P100)(PMID: 26157009).