LMO7 Recombinant monoclonal antibody, PBS Only (Capture)

LMO7 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84495-4-PBS
Clone No.241781D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

241781D11, FBX20, LOMP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84495-4-PBS targets LMO7 as part of a matched antibody pair:

MP01336-4: 84495-4-PBS capture and 84495-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30016

Product name: Recombinant human LMO7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 695-838 aa of NM_005358

Sequence: KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY

Predict reactive species
Full Name LIM domain 7
Calculated Molecular Weight 193 kDa
Observed Molecular Weight150 kDa, 180 kDa
GenBank Accession NumberNM_005358
Gene Symbol LMO7
Gene ID (NCBI) 4008
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8WWI1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LMO7, also known as LOMP, FBX20, belongs to the single Calponin-homology (CH) domain-containing protein family, with a single actin-binding CH domain at the amino terminal end(PMID: 19459066). LMO7 also contains a PDZ domain and a carboxyl-terminal LIM domain, both of which have been described as protein-protein interacting domains(PMID: 15140894). LMO7 encodes three splice variants of calculated molecular weights of 196 kDa (P200), 157 kDa (P150), and 100 kDa (P100)(PMID: 26157009).

Loading...
||
New chat Able
正在加载,请稍候...