LOC221710 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LOC221710 Polyclonal antibody (34416-1-AP)

• 

  WB analysis using 34416-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34416-1-AP (LOC221710 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

LOC221710 Polyclonal Antibody for WB, ELISA

Cat No. 34416-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C6orf228, Small integral membrane protein 13, SMIM13

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HCT116, HeLa, Jurkat, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34416-1-AP targets LOC221710 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag42308

  Product name: Recombinant human LOC221710 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-91 aa of BC032356

  Sequence: WHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT

• Full Name: hypothetical protein LOC221710
• Observed Molecular Weight: 19-23 kDa
• GenBank Accession Number: BC032356
• Gene Symbol: LOC221710
• Gene ID (NCBI): 221710
• RRID: AB_3743197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0DJ93
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LOC221710 is a provisional gene annotation identifier used in human genomic databases (e.g., RefSeq/NCBI) to denote a predicted or poorly characterized locus for which functional annotation remains limited. Genes labeled with "LOC" typically arise from computational gene prediction, transcriptomic evidence, or incomplete cDNA characterization, and may represent protein-coding candidates, long non-coding RNAs (lncRNAs), or pseudogenes. For LOC221710, currently available data suggest that it lacks well-defined protein structure, biochemical function, and experimentally validated biological roles, and it has not yet been assigned an official gene symbol.