• Featured Product
  • KD/KO Validated

LPCAT1 Monoclonal antibody, PBS Only (Capture)

LPCAT1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 66044-1-PBS
Clone No.8B6E9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Acetyl-CoA:lyso-PAF acetyltransferase, 8B6E9, 1-alkylglycerophosphocholine O-acetyltransferase, 1-alkenylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphocholine O-acyltransferase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66044-1-PBS targets LPCAT1 as part of a matched antibody pair:

MP50776-2: 66044-1-PBS capture and 66044-3-PBS detection (validated in Cytometric bead array)

MP50776-3: 66044-1-PBS capture and 66044-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9060

Product name: Recombinant human LPCAT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 51-395 aa of BC020166

Sequence: IKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD

Predict reactive species
Full Name lysophosphatidylcholine acyltransferase 1
Calculated Molecular Weight 534 aa, 59 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC020166
Gene Symbol LPCAT1
Gene ID (NCBI) 79888
RRIDAB_11045658
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8NF37
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LPCAT1, also named as AYTL2, PFAAP3 and LysoPAFAT, belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. It is a key enzyme for remodeling phospholipids, including phosphatidylcholine. The expression level of LPCAT1 is able to differentiate prostate cancer from noncancerous prostatic changes, and correlates to the tumor grade of prostate cancer. LPCAT1 possesses both acyltransferase and acetyltransferase activities. It mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC).

Loading...
||
New chat

Able

正在加载,请稍候...