• Featured Product
  • KD/KO Validated

LPCAT1 Monoclonal antibody

LPCAT1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66044-1-Ig
Clone No.8B6E9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Acetyl-CoA:lyso-PAF acetyltransferase, 8B6E9, 1-alkylglycerophosphocholine O-acetyltransferase, 1-alkenylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphocholine O-acyltransferase

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, MCF-7 cells, PC-12 cells, ROS1728 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cellls, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
Positive IHC detected inhuman lung cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse lung tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66044-1-Ig targets LPCAT1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9060

Product name: Recombinant human LPCAT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 51-395 aa of BC020166

Sequence: IKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD

Predict reactive species
Full Name lysophosphatidylcholine acyltransferase 1
Calculated Molecular Weight 534 aa, 59 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC020166
Gene Symbol LPCAT1
Gene ID (NCBI) 79888
RRIDAB_11045658
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8NF37
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LPCAT1, also named as AYTL2, PFAAP3 and LysoPAFAT, belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. It is a key enzyme for remodeling phospholipids, including phosphatidylcholine. The expression level of LPCAT1 is able to differentiate prostate cancer from noncancerous prostatic changes, and correlates to the tumor grade of prostate cancer. LPCAT1 possesses both acyltransferase and acetyltransferase activities. It mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC).

Protocols

Product Specific Protocols
WB protocol for LPCAT1 antibody 66044-1-IgDownload protocol
IHC protocol for LPCAT1 antibody 66044-1-IgDownload protocol
IF protocol for LPCAT1 antibody 66044-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

Oncogene Amplification in Growth Factor Signaling Pathways Renders Cancers Dependent on Membrane Lipid Remodeling.

Authors - Junfeng Bi
  • KD Validated
mouse,ratWB

Biochim Biophys Acta Mol Basis Dis

Stearoyl-CoA desaturase 1 deficiency exacerbates palmitate-induced lipotoxicity by the formation of small lipid droplets in pancreatic β-cells

Authors - Justyna Janikiewicz
mouse, humanIHC, WB

Front Oncol

Gut Microbiota Dysbiosis Accelerates Prostate Cancer Progression Through Increased LPCAT1 Expression and Enhanced DNA Repair Pathways.

Authors - Yufei Liu
mouseIHC

Sci Rep

No evidence for carcinogenicity of titanium dioxide nanoparticles in 26-week inhalation study in rasH2 mouse model

Authors - Shotaro Yamano
humanWB

Biochem Biophys Res Commun

A miR-205-LPCAT1 axis contributes to proliferation and progression in multiple cancers.

Authors - Fang Liu
  • KD Validated
humanWB,IF,IHC

Cell Death Dis

LPCAT1 reprogramming cholesterol metabolism promotes the progression of esophageal squamous cell carcinoma.

Authors - Mingyue Tao
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...