Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated LPCAT1 Monoclonal antibody

LPCAT1 Monoclonal Antibody for IF/ICC

Cat No. CL488-66044
Clone No.8B6E9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC

Acyltransferase like 2, AYTL2, FLJ12443, FLJ41609, LPC acyltransferase 1, lpcat, LPCAT 1, LPCAT1, Lyso PAF acetyltransferase, LysoPAFAT, LysoPC acyltransferase 1, PFAAP3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66044 targets LPCAT1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9060

Product name: Recombinant human LPCAT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 51-395 aa of BC020166

Sequence: IKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD

Predict reactive species
Full Name lysophosphatidylcholine acyltransferase 1
Calculated Molecular Weight 534 aa, 59 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC020166
Gene Symbol LPCAT1
Gene ID (NCBI) 79888
RRIDAB_2883237
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8NF37
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

LPCAT1, also named as AYTL2, PFAAP3 and LysoPAFAT, belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. It is a key enzyme for remodeling phospholipids, including phosphatidylcholine. The expression level of LPCAT1 is able to differentiate prostate cancer from noncancerous prostatic changes, and correlates to the tumor grade of prostate cancer. LPCAT1 possesses both acyltransferase and acetyltransferase activities. It mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 LPCAT1 antibody CL488-66044Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...