LPLUNC1 Polyclonal antibody

• 

  WB analysis using 24699-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24699-1-AP (LPLUNC1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

LPLUNC1 Polyclonal Antibody for WB, ELISA

Cat No. 24699-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

BPIFB1, BPI fold-containing family B member 1, C20orf114, VEMSGP

---

Tested Applications

• Positive WB detected in: human saliva

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24699-1-AP targets LPLUNC1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20056

  Product name: Recombinant human C20orf114 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 225-325 aa of BC008429

  Sequence: LSIDRLEFDLLYPAIKGDTIQLYLGAKLLDSQGKVTKWFNNSAASLTMPTLDNIPFSLIVSQDVVKAAVAAVLSPEEFMVLLDSVLPESAHRLKSSIGLIN

• Full Name: chromosome 20 open reading frame 114
• Calculated Molecular Weight: 484 aa, 52 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC008429
• Gene Symbol: C20orf114
• Gene ID (NCBI): 92747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDL5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LPLUNC1 (Long Palate, Lung and Nasal Epithelium Carcinoma-Associated Protein 1) is a member of the PLUNC protein family and is a secretory protein primarily expressed in the mucosal epithelium of the respiratory tract. As a key component of innate immunity, LPLUNC1 exhibits antimicrobial activity by directly binding to lipopolysaccharides and inhibiting bacterial growth. Recent studies have revealed that LPLUNC1 expression is significantly downregulated in various tumors, including nasopharyngeal carcinoma and lung cancer. It exerts tumor-suppressive effects by regulating signaling pathways such as NF-κB and STAT3, thereby inhibiting tumor cell proliferation and promoting apoptosis. Its expression level is closely associated with tumor stage and prognosis, making it a potential diagnostic biomarker and therapeutic target for cancer.