LRIG1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LRIG1 Polyclonal antibody (22383-1-AP)

LRIG1 Polyclonal Antibody for WB, ELISA

Cat No. 22383-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Leucine-rich repeats and immunoglobulin-like domains protein 1, LIG 1, LIG1, LIG-1

• 

  WB analysis of mouse liver using 22383-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 22383-1-AP (LRIG1 Antibody) at dilution of 1:1000 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skin using 22383-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 22383-1-AP (LRIG1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LRIG1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse skin tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22383-1-AP targets LRIG1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17880

  Product name: Recombinant human LRIG1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 45-397 aa of BC071561

  Sequence: CTCAGDSLDCGGRGLAALPGDLPSWTRSLNLSYNKFSEIDPAGFEDLPNLQEVYLNNNELTAVPSLGAASSHVVSLFLQHNKIRSVEGSQLKAYLSLEVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLELGAFDGLSRSLLTLRLSKNRITQLPVRAFKLPRLTQLDLNRNRIRLIEGLTFQGLNSLEVLKLQRNNISKLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSIARIHRKGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGAFKGLRSLRVLDLDHNEISGTIEDTSGAFSGLDSLSKLLLLEPSQSAG

• Full Name: leucine-rich repeats and immunoglobulin-like domains 1
• Calculated Molecular Weight: 1093 aa, 119 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC071561
• Gene Symbol: LRIG1
• Gene ID (NCBI): 26018
• RRID: AB_2879095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JA1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LRIG1 acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation.

Publications

What published studies show

The LRIG1 Polyclonal antibody (Cat# 22383-1-AP) has 1 total citation. It appears in Cellular & Molecular Immunology (Impact Factor 23.9), published in August 2025. The cited study investigates how macrophage-derived VISTA interacts with LRIG1 to impair gut epithelial repair in colitis, placing the research within the fields of immunology, inflammatory bowel disease, and mucosal barrier biology. The antibody was used for Western blot in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Mol Immunol; Macrophage-derived VISTA engages with LRIG1 and hinders gut epithelial repair in colitis; Authors - Mengyuan Li