LRIT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LRIT2 Polyclonal antibody, PBS Only (32565-1-PBS)

• 

  WB analysis using 32565-1-AP (same clone as 32565-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32565-1-AP (LRIT2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32565-1-PBS in a different storage buffer formulation.

LRIT2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32565-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Leucine-rich repeat-containing protein 22, LRRC22

---

Product Information

32565-1-PBS targets LRIT2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38495

  Product name: Recombinant human LRIT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-250 aa of BC144475

  Sequence: AQPFCLPGCTCSEESFGRTLQCTSVSLGKIPGNLSEEFKQVRIENSPLFEMPQGSFINMSTLEYLWLNFNNISVIHLGALEHLPELRELRLEGNKLCSVPWTAFRATPLLRVLDLKRNKIDALPELALQFLVSLTYLDLSSNRLTVVSKSVFLNWPAYQKCRQPDCGAEILSSLVVALHDNPWVCDCRLRGLVQFVKSITLPVILVNSYLICQGPLSKAGQLFHETELSAC

• Full Name: leucine-rich repeat, immunoglobulin-like and transmembrane domains 2
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC144475
• Gene Symbol: LRIT2
• Gene ID (NCBI): 340745
• RRID: AB_3742657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A6NDA9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.