Home
Products
Primary Antibodies
LRP5 Polyclonal antibody, PBS Only (24899-1-PBS)

Filter: AllWBIHCIF/ICC

WB analysis of HeLa using 24899-1-AP (same clone as 24899-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 24899-1-AP (LRP5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24899-1-PBS in a different storage buffer formulation.
IHC staining of mouse lung using 24899-1-AP (same clone as 24899-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 24899-1-AP (LRP5 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24899-1-PBS in a different storage buffer formulation.
IHC staining of mouse lung using 24899-1-AP (same clone as 24899-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 24899-1-AP (LRP5 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24899-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 24899-1-AP (same clone as 24899-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24899-1-AP (LRP5 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24899-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 24899-1-AP (same clone as 24899-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24899-1-AP (LRP5 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24899-1-PBS in a different storage buffer formulation.
IHC staining of human hepatocirrhosis using 24899-1-AP (same clone as 24899-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 24899-1-AP (LRP5 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24899-1-PBS in a different storage buffer formulation.
IHC staining of human hepatocirrhosis using 24899-1-AP (same clone as 24899-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 24899-1-AP (LRP5 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24899-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 24899-1-AP (same clone as 24899-1-PBS)
Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 24899-1-AP (LRP5 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24899-1-PBS in a different storage buffer formulation.

LRP5 Polyclonal antibody, PBS Only

Name: LRP5 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24899-1-PBS

LRP5 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 24899-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

BMND1, LR3, LRP 5, LRP-5, LRP7

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

24899-1-PBS targets LRP5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag19034 Product name: Recombinant human LRP5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1332-1397 aa of BC150595 Sequence: CDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSL Predict reactive species
Full Name	low density lipoprotein receptor-related protein 5
Calculated Molecular Weight	1615 aa, 179 kDa
Observed Molecular Weight	180-200 kDa
GenBank Accession Number	BC150595
Gene Symbol	LRP5
Gene ID (NCBI)	4041
RRID	AB_2879786
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75197
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Low-density lipoprotein receptor-related protein 5 (LRP5) is a single-pass type I membrane protein with EGF-like and LDLR domains in the extracellular domain. LRP5 and LRP6 act as coreceptors with Frizzled for Wnt. The complex of Wnt-Fzd-LRP5-LRP6 triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes. LRP5 plays a key role in skeletal homeostasis and many bone density related diseases are caused by mutations in LRP5 gene.