LRRC17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LRRC17 Polyclonal antibody, PBS Only (20918-1-PBS)

• 

  WB analysis of HeLa using 20918-1-AP (same clone as 20918-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20918-1-AP (LRRC17 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20918-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20918-1-AP (same clone as 20918-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20918-1-AP (LRRC17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20918-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 20918-1-AP (same clone as 20918-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 20918-1-AP (LRRC17 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20918-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LRRC17 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20918-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

UNQ3076/PRO9909, p37NB, Leucine-rich repeat-containing protein 17

---

Product Information

20918-1-PBS targets LRRC17 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15117

  Product name: Recombinant human LRRC17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-441 aa of BC027903

  Sequence: KIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDNPWRCDYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVIITIVG

• Full Name: leucine rich repeat containing 17
• Calculated Molecular Weight: 441 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC027903
• Gene Symbol: LRRC17
• Gene ID (NCBI): 10234
• RRID: AB_2878763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8N6Y2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Leucine-rich repeat-containing protein 17 (LRRC17) is an LRR protein predominantly expressed by osteoblasts. LRRC17 acts as a negative regulator of receptor activator of NF-kappaB ligand (RANKL)-induced osteoclast differentiation (PMID: 19336404). It has been reported that low plasma level of LRRC17 is an independent risk factor for osteoporotic fractures (PMID: 27355564).