LRRC2 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse skeletal muscle using 84404-1-RR (same clone as 84404-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84404-1-RR (LRRC2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84404-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 84404-1-RR (same clone as 84404-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84404-1-RR (LRRC2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84404-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 84404-1-RR (same clone as 84404-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using LRRC2 antibody (84404-1-RR, Clone: 241132G1 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84404-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U-251 using 84404-1-RR (same clone as 84404-1-PBS)

  1x10^6 U-251 cells were intracellularly stained with 0.25 ug LRRC2 Recombinant antibody (84404-1-RR, Clone:241132G1) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 84404-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84404-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84404-1-RR against Human LRRC2 were performed. The affinity constant is 26.2 nM.

LRRC2 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 84404-1-PBS

Clone No.241132G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

Leucine-rich repeat-containing protein 2, 241132G1

---

Product Information

84404-1-PBS targets LRRC2 in IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27830

  Product name: Recombinant human LRRC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-200 aa of BC029118

  Sequence: ETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFIDTSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGN

• Full Name: leucine rich repeat containing 2
• Calculated Molecular Weight: 371 aa, 43 kDa
• GenBank Accession Number: BC029118
• Gene Symbol: LRRC2
• Gene ID (NCBI): 79442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9BYS8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Leucine Rich Repeat Containing 2 (LRRC2) was found to be localized to the mitochondria in human cells and transcriptionally regulated by the mitochondrial master regulator Pgc-1α. It has been reported that Lrrc2 transcript abundance correlates with that of β-MHC, a canonical marker of cardiac hypertrophy in humans, and experimentally demonstrated an elevation in Lrrc2 transcript in vitro and in vivo rodent models of cardiac hypertrophy as well as in patients with dilated cardiomyopathy. (PMID: 28158196)