LRRC20 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 25562-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 25562-1-AP (LRRC20 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of Y79 using 25562-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 25562-1-AP (LRRC20 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  IHC staining of human stomach cancer using 25562-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25562-1-AP (LRRC20 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 25562-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25562-1-AP (LRRC20 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human stomach cancer using 25562-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25562-1-AP (LRRC20 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 25562-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25562-1-AP (LRRC20 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 25562-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25562-1-AP (LRRC20 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 25562-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25562-1-AP (LRRC20 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 25562-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25562-1-AP (LRRC20 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 25562-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25562-1-AP (LRRC20 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of A431 using 25562-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using LRRC20 antibody (25562-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

LRRC20 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25562-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

UNQ2429/PRO4989, Leucine-rich repeat-containing protein 20

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, Y79 cells
• Positive IHC detected in: human stomach cancer tissue, human colon tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25562-1-AP targets LRRC20 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22119

  Product name: Recombinant human LRRC20 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-184 aa of BC024001

  Sequence: MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP

• Full Name: leucine rich repeat containing 20
• Calculated Molecular Weight: 184 aa, 21 kDa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: BC024001
• Gene Symbol: LRRC20
• Gene ID (NCBI): 55222
• RRID: AB_2880132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TCA0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.