LRRC29 Polyclonal antibody

• 

  WB analysis of mouse liver using 25664-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 25664-1-AP (LRRC29 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 25664-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 25664-1-AP (LRRC29 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

LRRC29 Polyclonal Antibody for WB, ELISA

Cat No. 25664-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

F box protein FBL9, F box/LRR repeat protein 9, FBL9, FBXL9, LRRC29

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25664-1-AP targets LRRC29 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22577

  Product name: Recombinant human LRRC29 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-223 aa of BC018785

  Sequence: MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL

• Full Name: leucine rich repeat containing 29
• Calculated Molecular Weight: 223 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC018785
• Gene Symbol: LRRC29
• Gene ID (NCBI): 26231
• RRID: AB_2880183
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WV35
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.