LRRC32 Polyclonal antibody

• 

  WB analysis of HUVEC using 26021-1-AP

  HUVEC cells were subjected to SDS PAGE followed by western blot with 26021-1-AP (LRRC32 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 26021-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26021-1-AP (LRRC32 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 26021-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26021-1-AP (LRRC32 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 26021-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 26021-1-AP (LRRC32 Antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 26021-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 26021-1-AP (LRRC32 Antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

LRRC32 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26021-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

D11S833E, GARP, Garpin, LRRC32

---

Tested Applications

• Positive WB detected in: HUVEC cells
• Positive IHC detected in: human tonsillitis tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26021-1-AP targets LRRC32 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23423

  Product name: Recombinant human LRRC32 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 477-662 aa of BC070079

  Sequence: PGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQYKA

• Full Name: leucine rich repeat containing 32
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC070079
• Gene Symbol: LRRC32
• Gene ID (NCBI): 2615
• RRID: AB_2880339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14392
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LRRC32, also known as GARP, is a transmembrane protein of 662 amino acids, the extracellular portion of which contains 20 leucine-rich repeats (PMID: 8180135). LRRC32 is a cell surface receptor on regulatory T-lymphocytes (Treg cells), platelets, hepatic stellate cells and certain cancer cells (PMID: 27054568). It has been demonstrated as a Treg-specific activation marker (PMID: 20137067). LRRC32 is critical for the surface expression of latent TGF-β by binding to the complex and functioning as its cell surface receptor (PMID: 19651619).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	iScience; GRP94 promotes anoikis resistance and peritoneal metastasis through YAP/TEAD1 pathway in gastric cancer; Authors - Qimeng Shi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Martina (Verified Customer) (07-09-2021)

Antibody worked well for WB and IHC, specificity confirmed by knockdown and over-extpression

• Applications: Western Blot, Immunohistochemistry
• Primary Antibody Dilution: 1:500 WB 1:5000 IHC
• Cell Tissue Type: Human Skin