LRRC57 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LRRC57 Polyclonal antibody, PBS Only (32285-1-PBS)

• 

  WB analysis using 32285-1-AP (same clone as 32285-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32285-1-AP (LRRC57 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32285-1-PBS in a different storage buffer formulation.

LRRC57 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32285-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Leucine-rich repeat-containing protein 57, Leucine Rich Repeat Containing 57

---

Product Information

32285-1-PBS targets LRRC57 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36790

  Product name: Recombinant human LRRC57 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-239 aa of BC058935

  Sequence: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFA

• Full Name: leucine rich repeat containing 57
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC058935
• Gene Symbol: LRRC57
• Gene ID (NCBI): 255252
• RRID: AB_3670231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N9N7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Increased expression of the LRRC57 (Leucine-rich repeat containing 57) gene has been associated with bipolar disorder. The other functions of LRRC57 are not fully understood, but it plays a role in a number of cellular processes, including cell proliferation, signaling, and metabolism.