Tested Applications
| Positive WB detected in | THP-1 cells |
| Positive IHC detected in | mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21601-1-AP targets LRRC8C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16213 Product name: Recombinant human LRRC8C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 618-803 aa of BC113973 Sequence: DLKENNLKSIEEIVSFQHLRKLTVLKLWHNSITYIPEHIKKLTSLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPPEIGVLQSLQYFSITCNKVESLPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPELGDCRALKRAGLVVEDALFETLPSDVREQMKTE Predict reactive species |
| Full Name | leucine rich repeat containing 8 family, member C |
| Calculated Molecular Weight | 803 aa, 92 kDa |
| Observed Molecular Weight | 92 kDa |
| GenBank Accession Number | BC113973 |
| Gene Symbol | LRRC8C |
| Gene ID (NCBI) | 84230 |
| RRID | AB_10733648 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TDW0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LRRC8C (Leucine-rich repeat-containing protein 8C), also known as AD158, is a non-essential component of the volume-regulated anion channel (VRAC, also known as VSOAC channel), which is required to maintain a constant cell volume in response to extracellular or intracellular permeability changes. The VRAC channel conducts iodide better than chloride and can also conduct organic osmolytes like taurine. The VRAC channel also mediates transport of immunoreactive cyclic dinucleotide GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol (PMID:24790029; 26824658; 28193731).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LRRC8C antibody 21601-1-AP | Download protocol |
| IHC protocol for LRRC8C antibody 21601-1-AP | Download protocol |
| WB protocol for LRRC8C antibody 21601-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LRRC8C Polyclonal antibody (Cat# 21601-1-AP) has 8 citations published in Nature Communications, Science Advances, Diabetes Metab J, Am J Physiol Cell Physiol, Biomedicines, and bioRxiv. Research fields span anti-tumor immunity and vasculature remodeling, cGAMP signaling and cell migration, platinum chemotherapy sensitivity, brown adipocyte function in diabetes, astrocytic volume-regulated anion channels, glioma growth inhibition, platelet activation and thrombosis, and lysosomal pH regulation with glucose metabolism.
| Species | Application | Title |
|---|---|---|
Nat Commun TET2-mediated tumor cGAS triggers endothelial STING activation to regulate vasculature remodeling and anti-tumor immunity in liver cancer | ||
Sci Adv 2'3'-cGAMP interactome identifies 2'3'-cGAMP/Rab18/FosB signaling in cell migration control independent of innate immunity | ||
Sci Adv Regulation of volume-regulated anion channels alters sensitivity to platinum chemotherapy | ||
Diabetes Metab J Single-Cell Landscape and a Macrophage Subset Enhancing Brown Adipocyte Function in Diabetes | ||
Am J Physiol Cell Physiol Subunit-specific roles of LRRC8 proteins in determining glutamate permeability of astrocytic volume-regulated anion channels.
| ||
Reviews
What customers say
Both reviewers used this antibody for Western Blot at a 1:1000 dilution and reported positive results. One user (5 stars) confirmed it worked as specified in Jurkat cells. The other (4 stars) successfully visualized LRRC8c in HUVECs and mouse lung tissue using overnight incubation at 4°C in 5% milk with a 1:5000 secondary antibody and 60-second exposure. Overall, users find the antibody reliable and effective at the recommended dilution for detecting its target across different cell types and tissues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jean-Baptiste (Verified Customer) (09-13-2026) | The antibody works at the dilution specified by the supplier in a Western blot
|
Joshua (Verified Customer) (08-16-2021) | This antibody was incubated at 4 degrees C O/N, in 5% Milk, and at a dilution ratio of 1:1,000. A secondary antibody at a dilution ratio of 1:5,000 was used. The acquired western blot image was achieved at an exposure time of 60 seconds. This product was vital in visualizing LRRC8c in both HUVECs and mouse lung tissue.
|







