Use Able AI chat for product recommendations

LRRC8C Polyclonal antibody

LRRC8C Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Volume-regulated anion channel subunit LRRC8C, Leucine-rich repeat-containing protein 8C, FAD158, AD158

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for LRRC8C in ?

Tested Applications

Positive WB detected inTHP-1 cells
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21601-1-AP targets LRRC8C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16213

Product name: Recombinant human LRRC8C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 618-803 aa of BC113973

Sequence: DLKENNLKSIEEIVSFQHLRKLTVLKLWHNSITYIPEHIKKLTSLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPPEIGVLQSLQYFSITCNKVESLPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPELGDCRALKRAGLVVEDALFETLPSDVREQMKTE

Predict reactive species
Full Name leucine rich repeat containing 8 family, member C
Calculated Molecular Weight 803 aa, 92 kDa
Observed Molecular Weight92 kDa
GenBank Accession NumberBC113973
Gene Symbol LRRC8C
Gene ID (NCBI) 84230
RRIDAB_10733648
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TDW0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LRRC8C (Leucine-rich repeat-containing protein 8C), also known as AD158, is a non-essential component of the volume-regulated anion channel (VRAC, also known as VSOAC channel), which is required to maintain a constant cell volume in response to extracellular or intracellular permeability changes. The VRAC channel conducts iodide better than chloride and can also conduct organic osmolytes like taurine. The VRAC channel also mediates transport of immunoreactive cyclic dinucleotide GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol (PMID:24790029; 26824658; 28193731).

Protocols

Product Specific Protocols
IF protocol for LRRC8C antibody 21601-1-APDownload protocol
IHC protocol for LRRC8C antibody 21601-1-APDownload protocol
WB protocol for LRRC8C antibody 21601-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The LRRC8C Polyclonal antibody (Cat# 21601-1-AP) has 8 citations published in Nature Communications, Science Advances, Diabetes Metab J, Am J Physiol Cell Physiol, Biomedicines, and bioRxiv. Research fields span anti-tumor immunity and vasculature remodeling, cGAMP signaling and cell migration, platinum chemotherapy sensitivity, brown adipocyte function in diabetes, astrocytic volume-regulated anion channels, glioma growth inhibition, platelet activation and thrombosis, and lysosomal pH regulation with glucose metabolism.

SpeciesApplicationTitle
mouseWB

Nat Commun

TET2-mediated tumor cGAS triggers endothelial STING activation to regulate vasculature remodeling and anti-tumor immunity in liver cancer

Authors - Hongwei Lv
humanWB

Sci Adv

2'3'-cGAMP interactome identifies 2'3'-cGAMP/Rab18/FosB signaling in cell migration control independent of innate immunity

Authors - Yu Deng
humanWB

Sci Adv

Regulation of volume-regulated anion channels alters sensitivity to platinum chemotherapy

Authors - Lily Elizabeth R Feldman
ratIF

Diabetes Metab J

Single-Cell Landscape and a Macrophage Subset Enhancing Brown Adipocyte Function in Diabetes

Authors - Junfei Gu
mouseWB

Am J Physiol Cell Physiol

Subunit-specific roles of LRRC8 proteins in determining glutamate permeability of astrocytic volume-regulated anion channels.

Authors - Madison L. Chandler
  • KD Validated
mouseWB,IF

Biomedicines

Astrocytes-Derived Small Extracellular Vesicles Hinder Glioma Growth

Authors - Carmela Serpe

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers used this antibody for Western Blot at a 1:1000 dilution and reported positive results. One user (5 stars) confirmed it worked as specified in Jurkat cells. The other (4 stars) successfully visualized LRRC8c in HUVECs and mouse lung tissue using overnight incubation at 4°C in 5% milk with a 1:5000 secondary antibody and 60-second exposure. Overall, users find the antibody reliable and effective at the recommended dilution for detecting its target across different cell types and tissues.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Jean-Baptiste (Verified Customer) (09-13-2026)

The antibody works at the dilution specified by the supplier in a Western blot

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Jurkat

Joshua (Verified Customer) (08-16-2021)

This antibody was incubated at 4 degrees C O/N, in 5% Milk, and at a dilution ratio of 1:1,000. A secondary antibody at a dilution ratio of 1:5,000 was used. The acquired western blot image was achieved at an exposure time of 60 seconds. This product was vital in visualizing LRRC8c in both HUVECs and mouse lung tissue.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1,000
  • Cell Tissue Type: HUVECs and Mouse Lung Tissue
Loading...
||
New chat

Able™

正在加载,请稍候...