LRRK2 Recombinant monoclonal antibody

• 

  WB analysis using 84062-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84062-3-RR (LRRK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

LRRK2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84062-3-RR

Clone No.241258B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

AURA17, Dardarin, EC:2.7.11.1, leucine rich repeat kinase 2, Leucine-rich repeat serine/threonine-protein kinase 2

---

Tested Applications

• Positive WB detected in: A549 cells, RAW 264.7 cells, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84062-3-RR targets LRRK2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33713

  Product name: Recombinant human LRRK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2372-2527 aa of NM_198578

  Sequence: VVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE*

• Full Name: leucine-rich repeat kinase 2
• Calculated Molecular Weight: 286 kDa
• Observed Molecular Weight: 286 kDa
• GenBank Accession Number: NM_198578
• Gene Symbol: LRRK2
• Gene ID (NCBI): 120892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q5S007
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Leucine-rich repeat kinase 2 (LRRK2) in humans is encoded by the PARK8/LRRK2 gene. Genetic variations within the LRRK2 gene are linked to a number of diseases, including Parkinson's disease (PD), Crohn's disease and Hansen's disease. The most frequent pathogenic mutations reside in the ROC-COR GTPase (R1441G/C/H, Y1669C) and kinase domains (G2019S, I2020T), indicating important roles for both enzymatic domains in the pathogenicity of LRRK2-driven PD. The G2019S mutation in the Leucine-rich repeat kinase-2 (LRRK2) protein is the most common pathogenic mutation, accounting for 1-6% of sporadic and 3-19% of familial PD. (PMID: 34991886,PMID: 30872638)