LSM14A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LSM14A Polyclonal antibody (18336-1-AP)

• Featured Product
• KD/KO Validated

LSM14A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18336-1-AP Copied!

Publications (21)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

AlphaSNBP, C19orf13, FAM61A, hRAP55, hRAP55A

• 

  WB analysis using 18336-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18336-1-AP (LSM14A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 18336-1-AP

  WB result of LSM14A antibody (18336-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LSM14A transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 18336-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18336-1-AP (LSM14A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 18336-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 18336-1-AP (LSM14A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 18336-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 18336-1-AP (LSM14A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 18336-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 18336-1-AP (LSM14A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 18336-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 18336-1-AP (LSM14A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 18336-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18336-1-AP (LSM14A antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 18336-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18336-1-AP (LSM14A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 18336-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 18336-1-AP (LSM14A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat colon using 18336-1-AP

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 18336-1-AP (LSM14A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 18336-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18336-1-AP (LSM14A antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 18336-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 18336-1-AP (LSM14A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 18336-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using LSM14A antibody (18336-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LSM14A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, PC-3 cells, HEK-293T cells, HepG2 cells, Jurkat cells
• Positive IHC detected in: human testis tissue, rat colon tissue, mouse ovary tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18336-1-AP targets LSM14A in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12997

  Product name: Recombinant human LSM14A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 100-463 aa of BC016842

  Sequence: SSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA

• Full Name: LSM14A, SCD6 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 463 aa, 51 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC016842
• Gene Symbol: LSM14A
• Gene ID (NCBI): 26065
• RRID: AB_10644339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8ND56
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LSm14A was originally discovered to be a component of the P-bodies, it is a member of the LSm family of proteins, which have been shown to be involved in RNA processing events. The N terminus of LSm14A is a conserved LSm domain, whereas the C terminus contains two domains called "DFDF box" and "FDF_TFG box", respectively.

Publications

What published studies show

LSM14A Polyclonal antibody (Cat# 18336-1-AP) has 21 citations published in journals including Nature Cell Biology, Cancer Research, Nucleic Acids Research, EMBO Journal, Oncogene, Cell Reports, and eLife. Research fields span P-body biology, stress granule assembly, RNA processing, phase separation, cancer (leukemia, EMT, glioblastoma, lung cancer, RCC metastasis), ciliogenesis, immune surveillance, viral infection, and lysosomal quality control. Applications cited include WB, IF, and CoIP.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Cell Biol; RNA sequestration in P-bodies sustains myeloid leukaemia; Authors - Srikanth Kodali
human	IF	Cancer Res; Pooled CRISPR Screening Identifies P-Bodies as Repressors of Cancer Epithelial-Mesenchymal Transition; Authors - Liang Fang
human	IF	Nucleic Acids Res; TIRR regulates mRNA export and association with P-bodies in response to DNA damage; Authors - Michelle S Glossop
human	IF	Nucleic Acids Res; RNA helicase DDX6 and scaffold protein GW182 in P-bodies promote biogenesis of stress granules; Authors - Vladimir Majerciak
human	IF	Adv Sci (Weinh); Oleic Acid Dissolves cGAS-DNA Phase Separation to Inhibit Immune Surveillance; Authors - Lina Wang
human	WB	MedComm (2020); FBXW7 Targets the SPT6-ΔNp63 Axis for Degradation to Inhibit Esophageal Tumorigenesis Induced by 4-Nitroquinoline N-Oxide.; Authors - Jiagui Zhang