LSM2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LSM2 Polyclonal antibody, PBS Only (10963-1-PBS)

• 

  WB analysis using 10963-1-AP (same clone as 10963-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10963-1-AP (LSM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10963-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10963-1-AP (same clone as 10963-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10963-1-AP (LSM2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10963-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10963-1-AP (same clone as 10963-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10963-1-AP (LSM2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10963-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10963-1-AP (same clone as 10963-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10963-1-AP (LSM2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10963-1-PBS in a different storage buffer formulation.

LSM2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10963-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

C6orf28, G7B, Protein G7b, snRNP, snRNP core Sm-like protein Sm-x5

---

Product Information

10963-1-PBS targets LSM2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1412

  Product name: Recombinant human LSM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC009192

  Sequence: MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

• Full Name: LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC009192
• Gene Symbol: LSM2
• Gene ID (NCBI): 57819
• RRID: AB_2138350
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y333
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing (PMID:15075370). Lsm2-Lsm8 (Lsm stands for Like Sm), binds and stabilizes the 3′ end of the spliceosomal U6 snRNA Lsm proteins facilitate the annealing of U6 snRNA with U4 snRNA in vitro and interact with the U4/U6 annealing factor Prp24, suggesting that Lsm proteins function in U4/U6 snRNP formation in vivo (PMID:15485930, 17251193).