LSM3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LSM3 Polyclonal antibody, PBS Only (15879-1-PBS)

• 

  WB analysis using 15879-1-AP (same clone as 15879-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15879-1-AP (LSM3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15879-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 15879-1-AP (same clone as 15879-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15879-1-AP (LSM3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15879-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 15879-1-AP (same clone as 15879-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 15879-1-AP (LSM3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15879-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 15879-1-AP (same clone as 15879-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15879-1-AP (LSM3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15879-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 15879-1-AP (same clone as 15879-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 15879-1-AP (LSM3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15879-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 15879-1-AP (same clone as 15879-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using LSM3 antibody (15879-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 15879-1-PBS in a different storage buffer formulation.

LSM3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15879-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

YLR438C, USS2, U6 snRNA-associated Sm-like protein LSm3, SMX4, MDS017

---

Product Information

15879-1-PBS targets LSM3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8641

  Product name: Recombinant human LSM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC007055

  Sequence: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

• Full Name: LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Calculated Molecular Weight: 102 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC007055
• Gene Symbol: LSM3
• Gene ID (NCBI): 27258
• RRID: AB_3669222
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62310
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LSM3, as a U6 snRNA-associated Sm-like protein, plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex)