LSM4 Polyclonal antibody

• 

  WB analysis of MCF-7 using 10834-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 10834-1-AP (LSM4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 10834-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 10834-1-AP (LSM4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MDA-MB-231 using 10834-1-AP

  MDA-MB-231 cells were subjected to SDS PAGE followed by western blot with 10834-1-AP (LSM4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 10834-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10834-1-AP (LSM4 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 10834-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10834-1-AP (LSM4 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 10834-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 10834-1-AP (LSM4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

LSM4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10834-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

YER112W, U6 snRNA-associated Sm-like protein LSm4, GRP, Glycine-rich protein, Glycine rich protein

---

Tested Applications

• Positive WB detected in: MCF7 cells, human placenta tissue, MDA-MB-231 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

10834-1-AP targets LSM4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1280

  Product name: Recombinant human LSM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-139 aa of BC022198

  Sequence: MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

• Full Name: LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC022198
• Gene Symbol: LSM4
• Gene ID (NCBI): 25804
• RRID: AB_2138361
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y4Z0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sm-like proteins, such as LSM4, were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO Rep; EDC3 phosphorylation regulates growth and invasion through controlling P-body formation and dynamics.; Authors - Jeremiah J Bearss
Mouse		J Neurosci; eIF2alpha Phosphorylation-dependent translation in CA1 pyramidal cells impairs hippocampal memory consolidation without affecting general translation.; Authors - Jiang Zhihong Z
human	WB	Mol Cell Biol; A quantitative high-throughput in vitro splicing assay identifies inhibitors of spliceosome catalysis.; Authors - Berg Michael G MG