Home
Products
Primary Antibodies
LSM6 Polyclonal antibody, PBS Only (12138-1-PBS)

Filter: AllIHC

IHC staining of human stomach using 12138-1-AP (same clone as 12138-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12138-1-AP (LSM6 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12138-1-PBS in a different storage buffer formulation.
IHC staining of human stomach using 12138-1-AP (same clone as 12138-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12138-1-AP (LSM6 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12138-1-PBS in a different storage buffer formulation.
IHC staining of human stomach using 12138-1-AP (same clone as 12138-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12138-1-AP (LSM6 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12138-1-PBS in a different storage buffer formulation.
IHC staining of human stomach using 12138-1-AP (same clone as 12138-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12138-1-AP (LSM6 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12138-1-PBS in a different storage buffer formulation.

LSM6 Polyclonal antibody, PBS Only

Name: LSM6 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 12138-1-PBS

LSM6 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 12138-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

12138-1-PBS targets LSM6 in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2784 Product name: Recombinant human LSM6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC016026 Sequence: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM Predict reactive species
Full Name	LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Calculated Molecular Weight	80 aa, 9 kDa
GenBank Accession Number	BC016026
Gene Symbol	LSM6
Gene ID (NCBI)	11157
RRID	AB_2616314
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P62312
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

LSM6 plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex) (PMID: 28781166). LSM6 is a component of LSm protein complexes, and LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA (PMID: 10523320).