Biotin-conjugated LSP1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Biotin-conjugated LSP1 Recombinant monoclonal antibody (Biotin-87378)

LSP1 Uni-rAb^® Recombinant Antibody for IHC

Cat No. Biotin-87378

Clone No.252179A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC

Synonyms

47 kDa actin-binding protein, Lymphocyte-specific antigen WP34, Lymphocyte-specific protein 1, pp52, WP34

• 

  IHC staining of human tonsillitis using Biotin-87378

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using Biotin-87378 (LSP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using Biotin-87378

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using Biotin-87378 (LSP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-87378 targets LSP1 in IHC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5464

  Product name: Recombinant Human LSP1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-339 aa of NM_002339.2

  Sequence: MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP

• Full Name: lymphocyte-specific protein 1
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: NM_002339.2
• Gene Symbol: LSP1
• Gene ID (NCBI): 4046
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P33241-1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Lymphocyte-specific protein 1(LSP1), also known as leukocyte-specific protein 1, is an F-actin binding and cytoskeleton associated protein. The protein is expressed in lymphocytes, neutrophils, and macrophages. LSP1 is a substrate for mitogen-activated protein kinase (MAPK)-activated protein kinase 2 and protein kinase C. The implication of LSP1 in diverse biological processes, such as inflammation and malignancy, suggests the major regulatory role of LSP1 in signal transduction(PMID: 38254711).