LSS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LSS Polyclonal antibody (13715-1-AP)

LSS Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13715-1-AP Copied!

Publications (26)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Oxidosqualene--lanosterol cyclase, OSC, Lanosterol synthase, hOSC, EC:5.4.99.7

• 

  WB analysis using 13715-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13715-1-AP (LSS antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 13715-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13715-1-AP (LSS antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13715-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13715-1-AP (LSS antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13715-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13715-1-AP (LSS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 13715-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13715-1-AP (LSS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 13715-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13715-1-AP (LSS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 13715-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13715-1-AP (LSS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 13715-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 13715-1-AP (LSS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13715-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13715-1-AP (LSS antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 13715-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 13715-1-AP (LSS antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 13715-1-AP

  IP result of anti-LSS (IP:13715-1-AP, 3ug; Detection:13715-1-AP 1:500) with HepG2 cells lysate 2900ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 13715-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13715-1-AP (LSS Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 13715-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13715-1-AP (LSS Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 13715-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 13715-1-AP (LSS Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 13715-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 13715-1-AP (LSS Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 13715-1-AP

  Immunofluorescent analysis of HepG2 cells using 13715-1-AP (LSS antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LSS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HT-1376 cells, PC-3 cells, HeLa cells, HepG2 cells, mouse testis tissue, human brain tissue, mouse pancreas tissue, mouse liver tissue, SH-SY5Y cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13715-1-AP targets LSS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4655

  Product name: Recombinant human LSS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 382-732 aa of BC035638

  Sequence: NGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYVQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP

• Full Name: lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)
• Calculated Molecular Weight: 732 aa, 83 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC035638
• Gene Symbol: LSS
• Gene ID (NCBI): 4047
• RRID: AB_10597096
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48449
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LSS, also named as OSC, is lanosterol synthase which catalyzes the cyclization of (S)-2,3 oxidosqualene to lanosterol, a reaction that forms the sterol nucleus. LSS gene has three isoforms with MW 74 kDa and 82-85 kDa. This antibody can recognize all these three isoforms.

Publications

What published studies show

The LSS Polyclonal antibody (Cat# 13715-1-AP) has 26 citations across journals including Nature Communications, Cell Host & Microbe, Neuron, Oncogene, Cell Reports, Signal Transduction and Targeted Therapy, Cancer Letters, Journal of Biological Chemistry, and others. Research fields span cholesterol biosynthesis and metabolism, cancer (colorectal, breast, hepatocellular, prostate, esophageal), cardiovascular disease, neurology, immunology, dermatology, ophthalmology, and endocrinology.

Automatically generated from the 26 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Signal Transduct Target Ther; Targeting intracellular cholesterol imbalance rescues sarcomere-ER contact site signaling and ER remodeling in dilated cardiomyopathy.; Authors - Nadezda Ignatyeva
human,mouse	WB	Cell Host Microbe; BCAA-producing Clostridium symbiosum promotes colorectal tumorigenesis through the modulation of host cholesterol metabolism; Authors - Yi-Meng Ren
human	WB	Nat Commun; Cholesterol-binding motifs in STING that control endoplasmic reticulum retention mediate anti-tumoral activity of cholesterol-lowering compounds; Authors - Bao-Cun Zhang
mouse	WB	Neuron; Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory.; Authors - Xiaohui Li
human	WB	Redox Biol; ALOX15B controls macrophage cholesterol homeostasis via lipid peroxidation, ERK1/2 and SREBP2; Authors - Yvonne Benatzy
		Cancer Lett; SQLE amplification accelerates esophageal squamous cell carcinoma tumorigenesis and metastasis through oncometabolite 2,3-oxidosqualene repressing Hippo pathway; Authors - Xuesong Liu