Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

LTBP1 Polyclonal antibody

LTBP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26855-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Latent-transforming growth factor beta-binding protein 1, LTBP 1, TGF beta1 BP 1, TGF-beta1-BP-1, Transforming growth factor beta-1-binding protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma tissue
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26855-1-AP targets LTBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25392

Product name: Recombinant human LTBP1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 600-739 aa of BC130289

Sequence: CSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCH

Predict reactive species
Full Name latent transforming growth factor beta binding protein 1
Calculated Molecular Weight 1721 aa, 187 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC130289
Gene Symbol LTBP1
Gene ID (NCBI) 4052
RRIDAB_2880658
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14766
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) is a large extracellular matrix protein that belongs to the latent TGF-beta binding protein family. It plays a crucial role in the regulation of TGF-beta, a multifunctional cytokine involved in various cellular processes such as cell growth, differentiation, and immune response. LTBP1 is essential for TGF-beta folding, secretion, matrix localization, and activation. It forms latent complexes with TGF-beta by covalently binding the TGF-beta propeptide (LAP) via disulfide bonds in the endoplasmic reticulum. This complex is then secreted and targeted to the extracellular matrix, where TGF-beta can be activated by various mechanism.

Protocols

Product Specific Protocols
IF protocol for LTBP1 antibody 26855-1-APDownload protocol
IHC protocol for LTBP1 antibody 26855-1-APDownload protocol
WB protocol for LTBP1 antibody 26855-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Cell Rep

TGF-β1-mediated intercellular signaling fuels cooperative cellular invasion

Authors - Tala O Khatib
humanIF

Cell Rep

Integrative single-cell meta-analysis reveals disease-relevant vascular cell states and markers in human atherosclerosis

Authors - Jose Verdezoto Mosquera
humanWB

Phytomedicine

Rg3 inhibits hypoxia-induced tumor exosomes from boosting pancreatic cancer vasculogenic mimicry through the HIF-1α/LARS1/mTOR axis

Authors - Tingting Zhao
humanWB,IHC

J Transl Med

LTBP1 promotes esophageal squamous cell carcinoma progression through epithelial-mesenchymal transition and cancer-associated fibroblasts transformation.

Authors - Rui Cai
  • KD Validated
humanWB

Cell Death Discov

ERRFI1 induces apoptosis of hepatocellular carcinoma cells in response to tryptophan deficiency.

Authors - Mingqing Cui
humanWB

Cell Commun Signal

PDPN(+)LTBP1(+) cancer-associated fibroblasts induce a liver pre-metastatic niche in gastric cancer via PDPN/YAP/LTBP1 and CCL11/CCR3 axis.

Authors - Zhenxiong Zhao
  • KD Validated

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Udesh (Verified Customer) (10-05-2022)

The Ab was used at 1:1000 dilution in NFDM overnight 4 degrees and detected a band close to 220 kD in 20ug cell lysate. Also tested for for positive IF staining at 1:250 dilution in 2% BSA overnight at 4 degrees.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Bone Marrow MSCs
LTBP1 Antibody Western Blot validation (1:1000 dilution) in Bone Marrow MSCs (Cat no:26855-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...