LTBR Polyclonal antibody

• 

  WB analysis of HeLa using 20331-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20331-1-AP (LTBR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 20331-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20331-1-AP (LTBR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 20331-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20331-1-AP (LTBR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 20331-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20331-1-AP (LTBR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human hepatocirrhosis using 20331-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20331-1-AP (LTBR antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 20331-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20331-1-AP (LTBR antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human hepatocirrhosis using 20331-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20331-1-AP (LTBR antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 20331-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20331-1-AP (LTBR antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 20331-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using LTBR antibody (20331-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of HeLa using 20331-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug LTBR Polyclonal antibody (20331-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2) (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

LTBR Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 20331-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

D12S370, LT BETA R, Lymphotoxin beta receptor, Lymphotoxin-beta receptor, TNF R III

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse brain tissue
• Positive IHC detected in: human hepatocirrhosis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 3 publications below
• IF: See 5 publications below

Product Information

20331-1-AP targets LTBR in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14065

  Product name: Recombinant human LTBR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 249-435 aa of BC026262

  Sequence: KSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD

• Full Name: lymphotoxin beta receptor (TNFR superfamily, member 3)
• Calculated Molecular Weight: 435 aa, 47 kDa
• Observed Molecular Weight: 47-60 kDa
• GenBank Accession Number: BC026262
• Gene Symbol: LTBR
• Gene ID (NCBI): 4055
• RRID: AB_10694276
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36941
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Adv Sci (Weinh); Plac1+ Tumor Cell-Treg Interplay Supports Tumorigenesis and Progression of Head and Neck Cancer; Authors - Xiaoyan Meng
mouse	IF	Mol Ther; Activation of NF-κB-Inducing Kinase in Islet β Cells Causes β Cell Failure and Diabetes.; Authors - Xinzhi Li
human	WB	J Immunol; SNX17 Affects T Cell Activation by Regulating TCR and Integrin Recycling.; Authors - Douglas G Osborne
human	WB,IHC,IF	Am J Pathol; Lymphotoxins Promote the Progression of Human Lymphatic Malformation by Enhancing Lymphatic Endothelial Cell Proliferation.; Authors - Jie-Gang Yang ; KD Validated
		Mol Med Rep; Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells.; Authors - Mo Shen
mouse	IF	Theranostics; Islet α-cell Inflammation Induced By NF-κB inducing kinase (NIK) Leads to Hypoglycemia, Pancreatitis, Growth Retardation, and Postnatal Death in Mice.; Authors - Xinzhi Li