LTBR Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LTBR Polyclonal antibody (20331-1-AP)

• Featured Product
• KD/KO Validated

LTBR Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 20331-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

D12S370, LT BETA R, Lymphotoxin beta receptor, Lymphotoxin-beta receptor, TNF R III

• 

  WB analysis of HeLa using 20331-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20331-1-AP (LTBR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 20331-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20331-1-AP (LTBR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 20331-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20331-1-AP (LTBR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 20331-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20331-1-AP (LTBR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 20331-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20331-1-AP (LTBR antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 20331-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20331-1-AP (LTBR antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 20331-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20331-1-AP (LTBR antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 20331-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20331-1-AP (LTBR antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 20331-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using LTBR antibody (20331-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 20331-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug LTBR Polyclonal antibody (20331-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2) (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LTBR in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse brain tissue
• Positive IHC detected in: human hepatocirrhosis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20331-1-AP targets LTBR in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14065

  Product name: Recombinant human LTBR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 249-435 aa of BC026262

  Sequence: KSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD

• Full Name: lymphotoxin beta receptor (TNFR superfamily, member 3)
• Calculated Molecular Weight: 435 aa, 47 kDa
• Observed Molecular Weight: 47-60 kDa
• GenBank Accession Number: BC026262
• Gene Symbol: LTBR
• Gene ID (NCBI): 4055
• RRID: AB_10694276
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36941
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lymphotoxin-beta receptor (LTBR) is a receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. It can activate the NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA1-LTB2) (PMID: 24248355). LTBR is constitutively expressed on stromal cells and myeloid lineage cells but not on T or B lymphocytes, which may be a novel immune checkpoint of tumor-associated macrophages (PMID: 20603617; 39429877).

Publications

What published studies show

The anti-LTβR antibody (Cat# 20331-1-AP) has 16 total citations published in journals including Cancer Cell, Nature Biotechnology, Nature Communications, Theranostics, Advanced Science, Cell Death & Differentiation, Molecular Therapy, Cell Discovery, Journal of Immunology, American Journal of Pathology, and others. Research fields span oncology (gastric, bladder, glioma, head and neck cancers), immunology, fibrosis, diabetes, cellular senescence, inflammation, and lymphatic biology.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell; B cells disrupt tertiary lymphoid structure formation and suppress anti-tumor immunity.; Authors - Changhao Chen
		Nat Biotechnol; Genome-wide mapping of RNA-protein associations through sequencing; Authors - Zhijie Qi
		Nat Commun; Noncanonical function of Pannexin1 promotes cellular senescence and renal fibrosis post-acute kidney injury; Authors - Liuwei Huang
mouse	IF	Theranostics; Islet α-cell Inflammation Induced By NF-κB inducing kinase (NIK) Leads to Hypoglycemia, Pancreatitis, Growth Retardation, and Postnatal Death in Mice.; Authors - Xinzhi Li
human	IF	Adv Sci (Weinh); Plac1+ Tumor Cell-Treg Interplay Supports Tumorigenesis and Progression of Head and Neck Cancer; Authors - Xiaoyan Meng
human	WB	Adv Sci (Weinh); Radiation-Induced Tumor-Intrinsic LTβR N-Glycosylation Suppresses Pyroptosis Through TRIM28-Mediated PCBP2 SUMOylation to Promote Gastric Cancer Radioresistance; Authors - Weijie Zang