Anti-Human LTBR Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human LTBR Rabbit Recombinant Antibody (98626-2-RR)

LTBR Uni-rAb^® Recombinant Antibody for FC

Cat No. 98626-2-RR

Clone No.251739F2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

D12S370, LT BETA R, Lymphotoxin beta receptor, Lymphotoxin-beta receptor, TNF R III

• 

  FC experiment of human PBMCs using 98626-2-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human LTBR Rabbit RecAb (98626-2-RR, Clone:251739F2), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. Cells were incubated with FC Receptor Block prior to staining.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using 98626-2-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human LTBR Rabbit RecAb (98626-2-RR, Clone:251739F2) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue),and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.Cells were incubated with FC Receptor Block prior to staining.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 98626-2-RR

  1x10^6 HeLa cells were surface stained with 0.25 ug Anti-Human LTBR Rabbit RecAb (98626-2-RR, Clone:251739F2) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 98626-2-RR

  Biolayer interferometry (BLl) kinetic assays of 98626-2-RR against Human LTBR were performed. The affinity constant is 2.39 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human PBMCs, HeLa cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98626-2-RR targets LTBR in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5126

  Product name: Recombinant Human LTBR protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 31-227 aa of BC026262

  Sequence: QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

• Full Name: lymphotoxin beta receptor (TNFR superfamily, member 3)
• Calculated Molecular Weight: 435 aa, 47 kDa
• GenBank Accession Number: BC026262
• Gene Symbol: LTBR
• Gene ID (NCBI): 4055
• RRID: AB_3746225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36941
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Lymphotoxin-beta receptor (LTBR) is a receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. It can activate the NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA1-LTB2) (PMID: 24248355). LTBR is constitutively expressed on stromal cells and myeloid lineage cells but not on T or B lymphocytes, which may be a novel immune checkpoint of tumor-associated macrophages (PMID: 20603617; 39429877).