LY6D Polyclonal antibody

• 

  WB analysis of A431 using 17361-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 17361-1-AP (LY6D antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 17361-1-AP

  WB result of LY6D antibody (17361-1-AP; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-LY6D transfected A431 cells.

• 

  IHC staining of human tonsillitis using 17361-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17361-1-AP (LY6D antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 17361-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17361-1-AP (LY6D Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human tonsillitis using 17361-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17361-1-AP (LY6D Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin cancer using 17361-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 17361-1-AP (LY6D antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skin cancer using 17361-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 17361-1-AP (LY6D antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

LY6D Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17361-1-AP

Publications(11)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

E48, E48 antigen, Ly 6D, Ly-6D, Lymphocyte antigen 6D

---

Tested Applications

• Positive WB detected in: A431 cells
• Positive IHC detected in: human skin cancer tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 3 publications below
• IF: See 6 publications below

Product Information

17361-1-AP targets LY6D in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10714

  Product name: Recombinant human LY6D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC031330

  Sequence: MRTALLLLATLAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPT

• Full Name: lymphocyte antigen 6 complex, locus D
• Calculated Molecular Weight: 128 aa, 13 kDa
• Observed Molecular Weight: 13-14 kDa
• GenBank Accession Number: BC031330
• Gene Symbol: LY6D
• Gene ID (NCBI): 8581
• RRID: AB_2878397
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14210
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LY6D, also named as E48 and ThB, may act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. It marks the earliest stage of B-cell specification.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	IF	Nat Commun; AP-1 and TGFß cooperativity drives non-canonical Hedgehog signaling in resistant basal cell carcinoma.; Authors - Catherine D Yao
mouse	IHC,IF	Cell Rep; Autocrine activation of MAPK signaling mediates intrinsic tolerance to androgen deprivation in LY6D prostate cancer cells; Authors - Ivana Steiner
mouse	WB	Diabetes; PMID: 28325853; Authors - Yu-Yao Zhang
mouse	IF	Elife; RUNX1 marks a luminal castration-resistant lineage established at the onset of prostate development.; Authors - Renaud Mevel
mouse,human	IHC,IF	Cancers (Basel); Lung Adenocarcinoma Mouse Models Based on Orthotopic Transplantation of Syngeneic Tumor-Initiating Cells Expressing EpCAM, SCA-1, and Ly6d.; Authors - Takashi Semba ; KD Validated
human	WB	PLoS One; Construction of ceRNA network to identify the lncRNA and mRNA related to non-small cell lung cancer.; Authors - Kui Xiao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

James (Verified Customer) (05-23-2025)

This antibody did not work for my samples (liver protein extract). It gave unspecific bands over 130 kDa

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: liver cells

LY6D Antibody Western Blot validation (1/1000 dilution) in liver cells (Cat no:17361-1-AP)