LY6G5C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LY6G5C Polyclonal antibody, PBS Only (24633-1-PBS)

• 

  WB analysis of mouse spleen using 24633-1-AP (same clone as 24633-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 24633-1-AP (LY6G5C Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24633-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 24633-1-AP (same clone as 24633-1-PBS)

  IP result of anti-LY6G5C (IP:24633-1-AP, 4ug; Detection:24633-1-AP 1:300) with K-562 cells lysate 1720ug. This data was developed using the same antibody clone with 24633-1-PBS in a different storage buffer formulation.

LY6G5C Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 24633-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

C6orf20, G5C, LY6G5CA, LY6G5CB, NG33

---

Product Information

24633-1-PBS targets LY6G5C in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18812

  Product name: Recombinant human LY6G5C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 41-147 aa of BC141637

  Sequence: VPVNWEPPQPLPFPKYLRCYRCLLETKELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCNDPQNRGLYTP

• Full Name: lymphocyte antigen 6 complex, locus G5C
• Calculated Molecular Weight: 150 aa, 17 kDa
• Observed Molecular Weight: 16 kDa, 32 kDa, 64 kDa
• GenBank Accession Number: BC141637
• Gene Symbol: LY6G5C
• Gene ID (NCBI): 80741
• RRID: AB_2879647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5SRR4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LY6G5C, also known as C6orf20, is a low abundance secreted protein. The function of LY6G5C, remains largely unknown. It may have a role in hematopoietic cell differentiation. Catalog#11714-1-AP can detect the protein and its dimmer and tetramer.