LY6K Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• LY6K Recombinant monoclonal antibody (87480-1-RR)

• 

  WB analysis using 87480-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87480-1-RR (LY6K antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87480-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87480-1-RR (LY6K antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

LY6K Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87480-1-RR

Clone No.252714A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CO16, HSJ001348, Ly 6K, Ly-6K, Lymphocyte antigen 6K

---

Tested Applications

• Positive WB detected in: HeLa cells, human testis tissue, 143B cells, DU145 cells, SiHa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87480-1-RR targets LY6K in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5676

  Product name: Recombinant human LY6K protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 18-138 aa of NM_017527.3

  Sequence: DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG

• Full Name: lymphocyte antigen 6 complex, locus K
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18-26 kDa
• GenBank Accession Number: NM_017527.3
• Gene Symbol: LY6K
• Gene ID (NCBI): 54742
• RRID: AB_3745570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q17RY6-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The LY6K (Lymphocyte antigen 6K) protein belongs to the LY6/uPAR superfamily and is a class of small glycoproteins that are anchored to the outer side of the cell membrane via glycosylphosphatidylinositol (GPI).